(data stored in ACNUC7421 zone)

EMBL: CP001958.PE38

CP001958.PE38        Location/Qualifiers
FT   CDS             31842..32357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckp:ckrop_3006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96531"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96531.1"
FT                   /translation="MTAEFSKRARALVELRSEGRCEGEFDPRERSKRPRCLRVAEEMHH
FT                   RRTRGSGGTSDPASSQVSNALALCRNCHHWAGQCFRLAEALGICVYQAHRPDARPVLIR
FT                   GEWRLLLDDGGLTPLIRVGEDEWRFDALGGHRYPAWLVDGATPLDERYVDVSGPLDANR
FT                   YATRWAVA"
     MTAEFSKRAR ALVELRSEGR CEGEFDPRER SKRPRCLRVA EEMHHRRTRG SGGTSDPASS        60
     QVSNALALCR NCHHWAGQCF RLAEALGICV YQAHRPDARP VLIRGEWRLL LDDGGLTPLI       120
     RVGEDEWRFD ALGGHRYPAW LVDGATPLDE RYVDVSGPLD ANRYATRWAV A                171
//

If you have problems or comments...

PBIL Back to PBIL home page