(data stored in ACNUC7421 zone)

EMBL: CP001958.PE384

CP001958.PE384       Location/Qualifiers
FT   CDS             complement(375043..376023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0390"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="KEGG: mgi:Mflv_1189 alcohol dehydrogenase; TIGRFAM:
FT                   NAD(P)H quinone oxidoreductase, PIG3 family; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96877"
FT                   /db_xref="GOA:D6ZBQ0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ0"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADG96877.1"
FT                   /translation="MRAIVVPSADGEAMFLAEAPRPEPGPRDVLIEVAAAGVNRADLAQ
FT                   RAGAYPPPPGASQILGLEVAGRIAEIGGEVTDWAVGDEVCALLAGGGYAQYAVAHEACV
FT                   LPVPPGATLAEAAGLPEVAATVWLNLGMIGGLAPGRRVLIHGGGSGVGTHAVQLVRAVG
FT                   AEAAVTASQGKADRCRELGAQIVIDYRTEDFADVLRRRWPDGADLVLDHIGGPYLARDL
FT                   KVLGLDGKILLIASIGGRHAEQIDLGALQLKRASVIGSTLRNRATGGTLGKAAIIAQVR
FT                   EHVWPLIAEGTVKPVLDRTFPLAEAEAAHRALAAGEIFGKTVLLA"
     MRAIVVPSAD GEAMFLAEAP RPEPGPRDVL IEVAAAGVNR ADLAQRAGAY PPPPGASQIL        60
     GLEVAGRIAE IGGEVTDWAV GDEVCALLAG GGYAQYAVAH EACVLPVPPG ATLAEAAGLP       120
     EVAATVWLNL GMIGGLAPGR RVLIHGGGSG VGTHAVQLVR AVGAEAAVTA SQGKADRCRE       180
     LGAQIVIDYR TEDFADVLRR RWPDGADLVL DHIGGPYLAR DLKVLGLDGK ILLIASIGGR       240
     HAEQIDLGAL QLKRASVIGS TLRNRATGGT LGKAAIIAQV REHVWPLIAE GTVKPVLDRT       300
     FPLAEAEAAH RALAAGEIFG KTVLLA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page