(data stored in ACNUC7421 zone)

EMBL: CP001958.PE385

CP001958.PE385       Location/Qualifiers
FT   CDS             complement(376056..376775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0391"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mav:MAV_1611
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96878"
FT                   /db_xref="GOA:D6ZBQ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96878.1"
FT                   /translation="MQSRTRASSNAKTPRKTAVKKTSAAKKTPAAKKNPASRIPIPKRQ
FT                   RRPTRAEVRKRLLDAALIVFGELGYTAASLDIVAAAAGLTKGAVYSNFSSKDELYFAMI
FT                   EDQLERRVAETNFAASGSADLDEISRFFTSNIFKERHWRLVWLEYWARVVREEELRQPY
FT                   LQARQQFATRIKEAFGPVRENLAKEAAGKKPSVELTEEELATVLLAVNEGLTVQALPDP
FT                   EKYPKELLGKLLRKLLS"
     MQSRTRASSN AKTPRKTAVK KTSAAKKTPA AKKNPASRIP IPKRQRRPTR AEVRKRLLDA        60
     ALIVFGELGY TAASLDIVAA AAGLTKGAVY SNFSSKDELY FAMIEDQLER RVAETNFAAS       120
     GSADLDEISR FFTSNIFKER HWRLVWLEYW ARVVREEELR QPYLQARQQF ATRIKEAFGP       180
     VRENLAKEAA GKKPSVELTE EELATVLLAV NEGLTVQALP DPEKYPKELL GKLLRKLLS        239
//

If you have problems or comments...

PBIL Back to PBIL home page