(data stored in ACNUC7421 zone)

EMBL: CP001958.PE388

CP001958.PE388       Location/Qualifiers
FT   CDS             complement(379208..379723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0394"
FT                   /product="Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
FT                   decarboxylase"
FT                   /note="PFAM: Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
FT                   decarboxylase; KEGG: msm:MSMEG_6116 putative OHCU
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96881"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ4"
FT                   /inference="protein motif:PFAM:PF09349"
FT                   /protein_id="ADG96881.1"
FT                   /translation="MHQGIGLEGLNALEPKSAVSALFECCHCVVLAERLAKARPYASRS
FT                   DLFSLADHELFRVDEETLGQIVASHPGVGSRPKSKASEGEQCAIWDQDHAVMSRLHAVV
FT                   GQYEAHFNRPFLIYAGELSAGEVIAVAEQRLHNDEETEGKVVRNELAKVHRHRLERMLG
FT                   PEGGYPLW"
     MHQGIGLEGL NALEPKSAVS ALFECCHCVV LAERLAKARP YASRSDLFSL ADHELFRVDE        60
     ETLGQIVASH PGVGSRPKSK ASEGEQCAIW DQDHAVMSRL HAVVGQYEAH FNRPFLIYAG       120
     ELSAGEVIAV AEQRLHNDEE TEGKVVRNEL AKVHRHRLER MLGPEGGYPL W                171
//

If you have problems or comments...

PBIL Back to PBIL home page