(data stored in ACNUC7421 zone)

EMBL: CP001958.PE391

CP001958.PE391       Location/Qualifiers
FT   CDS             381151..382635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0397"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/
FT                   D-alanyl-D-alanine-endopeptidase"
FT                   /note="KEGG: rer:RER_06180 D-alanyl-D-alanine
FT                   carboxypeptidase; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96884"
FT                   /db_xref="GOA:D6ZBQ7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ7"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADG96884.1"
FT                   /translation="MEFLARGTIPVPPSAVCAAWAISRYCVDMAPQQRSAPARPKHLAR
FT                   GVVVILVALVVVGVGLWGFQAYQSANAAAPAPAEPSPRSALRPEIRPVSPDAPSPAAAA
FT                   VAAVLDPLGDNPLLARFSGVVLDGVSGAALWQRDPDAAMTPASTMKLLTAASAVLSLPL
FT                   GARLATRVVAGSDPGQVVIVGAGDPTLSAAPDGEQSFYPGAARLDDLVAQVKQHHPGPV
FT                   DEVLVDDSAYEGPNFAQGWLPGDVADGFITPMDPLMLDGGRLDRSRDESPRTTTPALDT
FT                   GKELARRLGADPERTRLAPAPAGAVALAQVQSAPLRERILQFMLASDNVLAEAVGREVA
FT                   RGAGKPASFSGAVAAENEVLGKAGVDLAATRRLDSNGLSLDDRLSARTLARVLALATGR
FT                   SSGLRPLLDMLPVAGATGTLAERFRDPLSGQNTAGAGFVRAKTGSLDDVSTLAGETADQ
FT                   DGRMLVFAFLSNDGATWDTRAALDALASALRGCGCR"
     MEFLARGTIP VPPSAVCAAW AISRYCVDMA PQQRSAPARP KHLARGVVVI LVALVVVGVG        60
     LWGFQAYQSA NAAAPAPAEP SPRSALRPEI RPVSPDAPSP AAAAVAAVLD PLGDNPLLAR       120
     FSGVVLDGVS GAALWQRDPD AAMTPASTMK LLTAASAVLS LPLGARLATR VVAGSDPGQV       180
     VIVGAGDPTL SAAPDGEQSF YPGAARLDDL VAQVKQHHPG PVDEVLVDDS AYEGPNFAQG       240
     WLPGDVADGF ITPMDPLMLD GGRLDRSRDE SPRTTTPALD TGKELARRLG ADPERTRLAP       300
     APAGAVALAQ VQSAPLRERI LQFMLASDNV LAEAVGREVA RGAGKPASFS GAVAAENEVL       360
     GKAGVDLAAT RRLDSNGLSL DDRLSARTLA RVLALATGRS SGLRPLLDML PVAGATGTLA       420
     ERFRDPLSGQ NTAGAGFVRA KTGSLDDVST LAGETADQDG RMLVFAFLSN DGATWDTRAA       480
     LDALASALRG CGCR                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page