(data stored in ACNUC7421 zone)

EMBL: CP001958.PE392

CP001958.PE392       Location/Qualifiers
FT   CDS             382620..383612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0398"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: nfa:nfa3880 hypothetical protein; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96885"
FT                   /db_xref="GOA:D6ZBQ8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ8"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADG96885.1"
FT                   /translation="MRLPVSSPAQPGGVVLWELRKALRAWLAQHAPAQARVCVALSGGA
FT                   DSLALTAALAREHTAVEALVVDHGLQPESAQTAARAAQLALDLGCSGSRVLPVTVNGAG
FT                   GLEAAARTARQAALRQAGAGSPVLLGHTLDDQAETVLLGLARGSGPRSIQGMRAWDDPW
FT                   GRPLLGVRRAMTRAVCAELGVQPHEDPMNTDPRFVRARLRAEVLPLLEDVLQGGVAEAL
FT                   ARTADAVRADNGHLDEEAAAVYAKIGGAKIAVTDVAGLPGPIRRRVLRLWLMGNGAGAL
FT                   TETQIRSVDALASAWRGQGPVAVPAAGPQGGGRRLMARRSYGRLELEIR"
     MRLPVSSPAQ PGGVVLWELR KALRAWLAQH APAQARVCVA LSGGADSLAL TAALAREHTA        60
     VEALVVDHGL QPESAQTAAR AAQLALDLGC SGSRVLPVTV NGAGGLEAAA RTARQAALRQ       120
     AGAGSPVLLG HTLDDQAETV LLGLARGSGP RSIQGMRAWD DPWGRPLLGV RRAMTRAVCA       180
     ELGVQPHEDP MNTDPRFVRA RLRAEVLPLL EDVLQGGVAE ALARTADAVR ADNGHLDEEA       240
     AAVYAKIGGA KIAVTDVAGL PGPIRRRVLR LWLMGNGAGA LTETQIRSVD ALASAWRGQG       300
     PVAVPAAGPQ GGGRRLMARR SYGRLELEIR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page