(data stored in ACNUC7421 zone)

EMBL: CP001958.PE393

CP001958.PE393       Location/Qualifiers
FT   CDS             383634..384239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0399"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: mjl:Mjls_5161 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96886"
FT                   /db_xref="GOA:D6ZBQ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ9"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADG96886.1"
FT                   /translation="MNESAVAAAPQANWYDADVLSVVLTEEQIAARTTQLAHQIAQNHP
FT                   YRPGQPRSEDLLLVTVLKGAVMFTADLARSLPIPSQLEFMVVSSYGAATKSSGVVRIVK
FT                   DLDRDIRGRDVLVVEDVVDSGLTLSWLLRHLAAREPKSLEVCALLRKPEAQEAPVALDY
FT                   VGFDIPNVFVVGYGLDFDERYRDLPYLGELDPAAVERP"
     MNESAVAAAP QANWYDADVL SVVLTEEQIA ARTTQLAHQI AQNHPYRPGQ PRSEDLLLVT        60
     VLKGAVMFTA DLARSLPIPS QLEFMVVSSY GAATKSSGVV RIVKDLDRDI RGRDVLVVED       120
     VVDSGLTLSW LLRHLAAREP KSLEVCALLR KPEAQEAPVA LDYVGFDIPN VFVVGYGLDF       180
     DERYRDLPYL GELDPAAVER P                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page