(data stored in ACNUC7421 zone)

EMBL: CP001958.PE395

CP001958.PE395       Location/Qualifiers
FT   CDS             complement(385249..385983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0401"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase related
FT                   protein; KEGG: mmi:MMAR_0754 phosphatidylserine
FT                   decarboxylase; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96888"
FT                   /db_xref="GOA:D6ZBR1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR1"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ADG96888.1"
FT                   /translation="MALPPRRQGATGPSAELERFLDLIKATLPPPHPAGYPFIFAGLGA
FT                   AALSAAAPGRAGAALRRGGLAAAAACAVFFRNPRRAAPDDPSLVVAPADGRVSLVDTAA
FT                   PPGELGFGDEPRTRVSIFLSVFDVHVQHAPVAGQVLAATHRAGAFVSAERPEASERNER
FT                   QSLVIEEALTRKPVVVVQIAGLLARRIVCDATAGSSLRRGEVYGLIRFGSRVDVYLPAG
FT                   TKPLVKVGQRAVAGETALAALA"
     MALPPRRQGA TGPSAELERF LDLIKATLPP PHPAGYPFIF AGLGAAALSA AAPGRAGAAL        60
     RRGGLAAAAA CAVFFRNPRR AAPDDPSLVV APADGRVSLV DTAAPPGELG FGDEPRTRVS       120
     IFLSVFDVHV QHAPVAGQVL AATHRAGAFV SAERPEASER NERQSLVIEE ALTRKPVVVV       180
     QIAGLLARRI VCDATAGSSL RRGEVYGLIR FGSRVDVYLP AGTKPLVKVG QRAVAGETAL       240
     AALA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page