(data stored in ACNUC7421 zone)

EMBL: CP001958.PE399

CP001958.PE399       Location/Qualifiers
FT   CDS             complement(388468..389142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0405"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mab:MAB_4299c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96892"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG96892.1"
FT                   /translation="MAPAVRRALVSIASAIAPLALAASATAAPTMAAAPPWFAGQVGGA
FT                   QQVVAVLGDQTGHANVEVWGKYNGQWWSMTGPLPGHVGSAGVTDHARDGYPATPAGVFT
FT                   LPWAFGTDPAPATALPYHRTGPNDWWVGDVKSPLYNSFSQCAPGSCPFSEKESEQLAIP
FT                   QYALAVVMGVNPQRTPGAGGAFFLHVQDGGPTAGCVSIDKEALRSLITWLKPGAVIAIR
FT                   RA"
     MAPAVRRALV SIASAIAPLA LAASATAAPT MAAAPPWFAG QVGGAQQVVA VLGDQTGHAN        60
     VEVWGKYNGQ WWSMTGPLPG HVGSAGVTDH ARDGYPATPA GVFTLPWAFG TDPAPATALP       120
     YHRTGPNDWW VGDVKSPLYN SFSQCAPGSC PFSEKESEQL AIPQYALAVV MGVNPQRTPG       180
     AGGAFFLHVQ DGGPTAGCVS IDKEALRSLI TWLKPGAVIA IRRA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page