(data stored in ACNUC7421 zone)

EMBL: CP001958.PE40

CP001958.PE40        Location/Qualifiers
FT   CDS             33289..33654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96533"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96533.1"
FT                   /translation="MITEQEVVLVLRKISANDKRKPDQFELDEFVSAARRHNWTYREAC
FT                   AQVDAFFDIPRGGERITHGHITAGIKADRRHPKPVADVLQLEGPKPASEDNPDRQRVLA
FT                   MVRELSRKFSMPEETAR"
     MITEQEVVLV LRKISANDKR KPDQFELDEF VSAARRHNWT YREACAQVDA FFDIPRGGER        60
     ITHGHITAGI KADRRHPKPV ADVLQLEGPK PASEDNPDRQ RVLAMVRELS RKFSMPEETA       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page