(data stored in ACNUC7421 zone)

EMBL: CP001958.PE401

CP001958.PE401       Location/Qualifiers
FT   CDS             complement(390056..390718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96894"
FT                   /db_xref="GOA:D6ZBR7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96894.1"
FT                   /translation="MPIATLALGQRECKEQSGGQRLAAKYALPMRLFRRASGLLSLPLT
FT                   AAVAVWAITSGWSAEFFISFFLTAVLPSTVLCITRYRRERELTAGMSWAQAVSLLGLFV
FT                   FGLTAVENGGESRRGEWPGSHSRWTRLTGWSPDSASASESVARLALGVALLAWLALFVL
FT                   LILDLRRHLVTGWNTRPDPFPSGPANRRRDLRAKSSAGQRAQIPNRSRRNDEPGARG"
     MPIATLALGQ RECKEQSGGQ RLAAKYALPM RLFRRASGLL SLPLTAAVAV WAITSGWSAE        60
     FFISFFLTAV LPSTVLCITR YRRERELTAG MSWAQAVSLL GLFVFGLTAV ENGGESRRGE       120
     WPGSHSRWTR LTGWSPDSAS ASESVARLAL GVALLAWLAL FVLLILDLRR HLVTGWNTRP       180
     DPFPSGPANR RRDLRAKSSA GQRAQIPNRS RRNDEPGARG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page