(data stored in ACNUC7421 zone)

EMBL: CP001958.PE403

CP001958.PE403       Location/Qualifiers
FT   CDS             392655..393560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0409"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mab:MAB_4135c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96896"
FT                   /db_xref="GOA:D6ZBR9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR9"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ADG96896.1"
FT                   /translation="MSQASAAEPHPHVDLADTSGFTVLDDDDDDPLLLAPGGTAVDTWR
FT                   EGYPYEERLSRHQYEQEKRLLQIELLKLQQWSKKTGQRHVILFEGRDAAGKGGTIKRFM
FT                   EHLNPRGARVVALEKPTERELTQWYFQRYAQHLPAAGEMVFFDRSWYNRGGVERVMGFC
FT                   TPVQHAEFLRQAPMFEQMLAEDGISLTKFWFSVSRLEQRTRFAIRQVDPVRQWKLSPMD
FT                   LASLDKWDAYTAAKEEVFRFTDLAAAPWIVVKSNDKKRARLGAMRHVLSKFEYENKDHE
FT                   IVGAPDPLIVGRAADLLRGE"
     MSQASAAEPH PHVDLADTSG FTVLDDDDDD PLLLAPGGTA VDTWREGYPY EERLSRHQYE        60
     QEKRLLQIEL LKLQQWSKKT GQRHVILFEG RDAAGKGGTI KRFMEHLNPR GARVVALEKP       120
     TERELTQWYF QRYAQHLPAA GEMVFFDRSW YNRGGVERVM GFCTPVQHAE FLRQAPMFEQ       180
     MLAEDGISLT KFWFSVSRLE QRTRFAIRQV DPVRQWKLSP MDLASLDKWD AYTAAKEEVF       240
     RFTDLAAAPW IVVKSNDKKR ARLGAMRHVL SKFEYENKDH EIVGAPDPLI VGRAADLLRG       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page