(data stored in ACNUC7421 zone)

EMBL: CP001958.PE405

CP001958.PE405       Location/Qualifiers
FT   CDS             complement(394051..395118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0411"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   ferredoxin; KEGG: mab:MAB_3918c putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96898"
FT                   /db_xref="GOA:D6ZBS1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS1"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ADG96898.1"
FT                   /translation="MTAAPAADRSQLGAHVRQLTIAEVVQETKDAVSIAFRIPDDMVEA
FT                   FKYWPGQYLTLRIPSERTGSVARCYSICSSPHLDDDEILVTVKRTPEGYASNWLCDNAA
FT                   PGMSIPVLPPSGTFYPRSFGHDLLMFAAGSGITPIISIIKSALAAGTARVALFYANRDP
FT                   ESVIFAKQLAVYAEEFPDRFVVQHWLESEQGRPSAEALAAFTGGRQHSRVFMCGPAPFM
FT                   DAVAAAATGAGVEPAQLHREAYFSLDTDPFAPVEVRNTSELPPARVTVQLDDGEHVLAW
FT                   DRETPLLNHLLEQGLDVPYSCRQGECSSCVCSILDGEVRLLRNETLVDEDIRLGLTLAC
FT                   QAVPETDEVIIAFDQ"
     MTAAPAADRS QLGAHVRQLT IAEVVQETKD AVSIAFRIPD DMVEAFKYWP GQYLTLRIPS        60
     ERTGSVARCY SICSSPHLDD DEILVTVKRT PEGYASNWLC DNAAPGMSIP VLPPSGTFYP       120
     RSFGHDLLMF AAGSGITPII SIIKSALAAG TARVALFYAN RDPESVIFAK QLAVYAEEFP       180
     DRFVVQHWLE SEQGRPSAEA LAAFTGGRQH SRVFMCGPAP FMDAVAAAAT GAGVEPAQLH       240
     REAYFSLDTD PFAPVEVRNT SELPPARVTV QLDDGEHVLA WDRETPLLNH LLEQGLDVPY       300
     SCRQGECSSC VCSILDGEVR LLRNETLVDE DIRLGLTLAC QAVPETDEVI IAFDQ            355
//

If you have problems or comments...

PBIL Back to PBIL home page