(data stored in ACNUC7421 zone)

EMBL: CP001958.PE407

CP001958.PE407       Location/Qualifiers
FT   CDS             396504..397058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96900"
FT                   /db_xref="GOA:D6ZBS3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96900.1"
FT                   /translation="MAEDDPWAVPHTDLAALRAAENAGRRKIWPWVAVATVFVLGLAVG
FT                   AAVLAWFAKDSLDELRSTGKLGQVVYLRAHAYAEQGAANNAETADITYTVVRHLANKSQ
FT                   PQTQTFARTVSLPWEPPTQGTAVDLEGSLVEVVLTVKVPQKSNGNLAGPTCSMSLDNDL
FT                   LDNKTAAGYGNEVTCHWKFSK"
     MAEDDPWAVP HTDLAALRAA ENAGRRKIWP WVAVATVFVL GLAVGAAVLA WFAKDSLDEL        60
     RSTGKLGQVV YLRAHAYAEQ GAANNAETAD ITYTVVRHLA NKSQPQTQTF ARTVSLPWEP       120
     PTQGTAVDLE GSLVEVVLTV KVPQKSNGNL AGPTCSMSLD NDLLDNKTAA GYGNEVTCHW       180
     KFSK                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page