(data stored in ACNUC7421 zone)

EMBL: CP001958.PE411

CP001958.PE411       Location/Qualifiers
FT   CDS             400973..401239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa47600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96904"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96904.1"
FT                   /translation="MEIVSGSSVLGESTGPDAARWSSPLRKKGRLICVKAKKFASLQPK
FT                   KKCCKSQPRCLRCPVVLMRVEKAVDLDHAEKVPKWLLIQARKK"
     MEIVSGSSVL GESTGPDAAR WSSPLRKKGR LICVKAKKFA SLQPKKKCCK SQPRCLRCPV        60
     VLMRVEKAVD LDHAEKVPKW LLIQARKK                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page