(data stored in ACNUC7421 zone)

EMBL: CP001958.PE413

CP001958.PE413       Location/Qualifiers
FT   CDS             complement(401784..402443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_1216 surface layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96906.1"
FT                   /translation="MGVARTPALAALACFLAFGAAPLAGSPPAAAAPPCPALDDVEEKI
FT                   GDMQFDLENLRLVMNNAYASIDVKKHDEDFRLKTMINAFGYLGRAVAAAGDPGLSQQFE
FT                   AVTPDYEHMRDAVEGQFVVVQDDHDDFFSGVRYQSPRLAGTGADPDAYAAIDALEGGLR
FT                   DLSAALDPLREQGGCPAPGEGGAGADDESGAPDEDEPQCRFHPGSNQCDATGSILH"
     MGVARTPALA ALACFLAFGA APLAGSPPAA AAPPCPALDD VEEKIGDMQF DLENLRLVMN        60
     NAYASIDVKK HDEDFRLKTM INAFGYLGRA VAAAGDPGLS QQFEAVTPDY EHMRDAVEGQ       120
     FVVVQDDHDD FFSGVRYQSP RLAGTGADPD AYAAIDALEG GLRDLSAALD PLREQGGCPA       180
     PGEGGAGADD ESGAPDEDEP QCRFHPGSNQ CDATGSILH                              219
//

If you have problems or comments...

PBIL Back to PBIL home page