(data stored in ACNUC7421 zone)

EMBL: CP001958.PE414

CP001958.PE414       Location/Qualifiers
FT   CDS             402690..404786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0420"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: nfa:nfa3980 putative cell
FT                   division protein; PFAM: peptidase M41; AAA ATPase central
FT                   domain protein; peptidase M41 FtsH extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96907"
FT                   /db_xref="GOA:D6ZBT0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT0"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADG96907.1"
FT                   /translation="MNRSALIRIVVIVAAALAIWRIFSYVSDDTRGFQQVDTSVAMKQL
FT                   DDPANVESAVLEDSEQRLRLKLKHASSDTGGKTDVYAAIPGGALDKVFEQLEQLRKANG
FT                   SAAKYNVVNNDPGFLSQALVLYGPILLIGVLFYFAITRMQNSPRGFGFGRSRAKQLSKD
FT                   VPKVTFADVAGADEAVEELYEIKDFLQNPARYQALGAKIPRGVLLFGPPGTGKTLLARA
FT                   VAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQASPCIIFVDEIDAVGRQRGAG
FT                   FGGGHDEREQTLNQLLVEMDGFSERQGVIVMAATNRPDILDPALLRPGRFDRQIPVGNP
FT                   DIAGRRAILAVHGKGKPIAPDADLEGLAKRTVGMSGADLANVLNEAALLTARENGQLIT
FT                   TAALEESVDRVIGGPRRKSRIISELEKKIVAYHESGHTLAGWAMPGLDPVYKVTILARG
FT                   RTGGHAVTVPEDDKGLATRSELIARLVMLLGGRAAEELVFHEPTTGASSDIDRATKVAR
FT                   TMVMEYGMSARLGAVRYGDEQEDPFLGRAMGQRSDYSHEVAKEIDAEVRDLIEAAHTEA
FT                   WAVLVEYRDQLDALATQLLEKETLHQKELEEILAGVQKRPKITAFDVFGDRAPSDRPPV
FT                   KTPRELAVERGEPWPPVPPHVPAHAAGQDQGPAPDAPSPSRVPAPASASLASGPRAAQP
FT                   HQAG"
     MNRSALIRIV VIVAAALAIW RIFSYVSDDT RGFQQVDTSV AMKQLDDPAN VESAVLEDSE        60
     QRLRLKLKHA SSDTGGKTDV YAAIPGGALD KVFEQLEQLR KANGSAAKYN VVNNDPGFLS       120
     QALVLYGPIL LIGVLFYFAI TRMQNSPRGF GFGRSRAKQL SKDVPKVTFA DVAGADEAVE       180
     ELYEIKDFLQ NPARYQALGA KIPRGVLLFG PPGTGKTLLA RAVAGEAGVP FFTISGSDFV       240
     EMFVGVGASR VRDLFEQAKQ ASPCIIFVDE IDAVGRQRGA GFGGGHDERE QTLNQLLVEM       300
     DGFSERQGVI VMAATNRPDI LDPALLRPGR FDRQIPVGNP DIAGRRAILA VHGKGKPIAP       360
     DADLEGLAKR TVGMSGADLA NVLNEAALLT ARENGQLITT AALEESVDRV IGGPRRKSRI       420
     ISELEKKIVA YHESGHTLAG WAMPGLDPVY KVTILARGRT GGHAVTVPED DKGLATRSEL       480
     IARLVMLLGG RAAEELVFHE PTTGASSDID RATKVARTMV MEYGMSARLG AVRYGDEQED       540
     PFLGRAMGQR SDYSHEVAKE IDAEVRDLIE AAHTEAWAVL VEYRDQLDAL ATQLLEKETL       600
     HQKELEEILA GVQKRPKITA FDVFGDRAPS DRPPVKTPRE LAVERGEPWP PVPPHVPAHA       660
     AGQDQGPAPD APSPSRVPAP ASASLASGPR AAQPHQAG                               698
//

If you have problems or comments...

PBIL Back to PBIL home page