(data stored in ACNUC7421 zone)

EMBL: CP001958.PE416

CP001958.PE416       Location/Qualifiers
FT   CDS             405392..406249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0422"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   nml:Namu_0850 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96909"
FT                   /db_xref="GOA:D6ZBT2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT2"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADG96909.1"
FT                   /translation="MTPALTIMGVLNCTPDSFSGDGLASAPRGAGEAAVRAGLRLVAEG
FT                   ADIVDVGGESTRPGAAQVDPSEQLERILPAVRGLAAAGVFVSVDTCAAAVARAALAQGA
FT                   RMVNDVAGGLCDPELLTAAAEAGAWLVLGHWPGAPARDHGYRPGGTTAALVAQELSERA
FT                   GAALAAGVARDRIILDPGLGFGKNTEENWALIRGVHELRATGFPVLIGASRKRFLGSGL
FT                   PLASGHAEADQAELVWREAGTTAVTALAATLGAWGVRVHAPRPNRAAARAAAEFTGEGA
FT                   HHHG"
     MTPALTIMGV LNCTPDSFSG DGLASAPRGA GEAAVRAGLR LVAEGADIVD VGGESTRPGA        60
     AQVDPSEQLE RILPAVRGLA AAGVFVSVDT CAAAVARAAL AQGARMVNDV AGGLCDPELL       120
     TAAAEAGAWL VLGHWPGAPA RDHGYRPGGT TAALVAQELS ERAGAALAAG VARDRIILDP       180
     GLGFGKNTEE NWALIRGVHE LRATGFPVLI GASRKRFLGS GLPLASGHAE ADQAELVWRE       240
     AGTTAVTALA ATLGAWGVRV HAPRPNRAAA RAAAEFTGEG AHHHG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page