(data stored in ACNUC7421 zone)

EMBL: CP001958.PE419

CP001958.PE419       Location/Qualifiers
FT   CDS             407306..407779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96912"
FT                   /db_xref="GOA:D6ZBT5"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT5"
FT                   /inference="similar to AA sequence:KEGG:ROP_43280"
FT                   /protein_id="ADG96912.1"
FT                   /translation="MNRDVIVGCVACVAVGALWALCGPGITTMPQRLSSAAPLMLLGLM
FT                   EAGLGSYLKSRVRGNRIGLGPGLTPPVFVARVGRLASATVFMGAAFAGFWGSLAVYSFL
FT                   RAHQLLAAERNLPADLFGVAGAATLVAGAFWSRRCCRAPGDGSAGSCAGGAAP"
     MNRDVIVGCV ACVAVGALWA LCGPGITTMP QRLSSAAPLM LLGLMEAGLG SYLKSRVRGN        60
     RIGLGPGLTP PVFVARVGRL ASATVFMGAA FAGFWGSLAV YSFLRAHQLL AAERNLPADL       120
     FGVAGAATLV AGAFWSRRCC RAPGDGSAGS CAGGAAP                                157
//

If you have problems or comments...

PBIL Back to PBIL home page