(data stored in ACNUC7421 zone)

EMBL: CP001958.PE420

CP001958.PE420       Location/Qualifiers
FT   CDS             407927..408613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI18025 gene product from transcript GI18025-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96913"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96913.1"
FT                   /translation="MAPGHAMADPDDDTTPATSTSAPATGDAPAADEAPATSGSPTTTS
FT                   SYNPYATSSSPKPSAEDQDEAAPTAEPGDEDEDAPARPSVSASPAPAPSPAPASPEASP
FT                   APKPTNPAQVKAAACTFSREVTAQVAKDTKQFNELAAVENASWSDEDLAAASESARAGY
FT                   QTALDKIRSTVPTSGYPSDITAALTDLAHAADDWIYLIDNQNGDMIQGAISEYNDAVGR
FT                   LRTTCQ"
     MAPGHAMADP DDDTTPATST SAPATGDAPA ADEAPATSGS PTTTSSYNPY ATSSSPKPSA        60
     EDQDEAAPTA EPGDEDEDAP ARPSVSASPA PAPSPAPASP EASPAPKPTN PAQVKAAACT       120
     FSREVTAQVA KDTKQFNELA AVENASWSDE DLAAASESAR AGYQTALDKI RSTVPTSGYP       180
     SDITAALTDL AHAADDWIYL IDNQNGDMIQ GAISEYNDAV GRLRTTCQ                    228
//

If you have problems or comments...

PBIL Back to PBIL home page