(data stored in ACNUC7421 zone)

EMBL: CP001958.PE422

CP001958.PE422       Location/Qualifiers
FT   CDS             410236..411108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0428"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate/beta-alanine ligase; KEGG:
FT                   svi:Svir_35550 pantothenate synthetase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96915"
FT                   /db_xref="GOA:D6ZBT8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADG96915.1"
FT                   /translation="MSLGHTGPVLCHSPQQLRELADRLRAVGKHIALVPTMGALHHGHL
FT                   ALVEHAKRLPHATVVASVFVNPLQFGQGEDFERYPRPLAADLEALRQKKVRVVYTPAPA
FT                   AMYPLDGGGTQVVPGPLADELEGALRPGHFTGVLTVVMKLLAACGATWAVFGEKDYQQL
FT                   TLIRQMIRDLDLPVSAIGVPTVREEDGLALSSRNVYLSPHERQQAAGLSAALRAGAAEG
FT                   ERGPDAVLGAARATLEGYPGLAVDYLELRDPDLRQCPQRGPARLLVAARCGTTRLIDNM
FT                   PVSLGDGGR"
     MSLGHTGPVL CHSPQQLREL ADRLRAVGKH IALVPTMGAL HHGHLALVEH AKRLPHATVV        60
     ASVFVNPLQF GQGEDFERYP RPLAADLEAL RQKKVRVVYT PAPAAMYPLD GGGTQVVPGP       120
     LADELEGALR PGHFTGVLTV VMKLLAACGA TWAVFGEKDY QQLTLIRQMI RDLDLPVSAI       180
     GVPTVREEDG LALSSRNVYL SPHERQQAAG LSAALRAGAA EGERGPDAVL GAARATLEGY       240
     PGLAVDYLEL RDPDLRQCPQ RGPARLLVAA RCGTTRLIDN MPVSLGDGGR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page