(data stored in ACNUC7421 zone)

EMBL: CP001958.PE423

CP001958.PE423       Location/Qualifiers
FT   CDS             411108..411887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0429"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="KEGG: ami:Amir_0327 putative transcriptional
FT                   acitvator, Baf family; TIGRFAM: transcriptional activator,
FT                   Baf family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96916"
FT                   /db_xref="GOA:D6ZBT9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT9"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADG96916.1"
FT                   /translation="MLLVLDIGNSNVSFGLYEGSGSAARLVGSWRAHTDPKLTGDEIYL
FT                   AAEGFLGEHIDRVDGVSALSTVPALLRELRLMIPRYFPGRRSLVVEPGVRTGVPLLVDN
FT                   PKGVGADRVVNALAAFQQCQSACVVVDAGTTTVVDAVSAKGEFLGGAIAPGMAISVDAL
FT                   SQWAATIPKVELVRPRSVIGKSTVESLQSGVLFGFAGQVDGLVRRMIGEIGEARVVLTG
FT                   GLAPLLVDELATPFAHEPALTLTGLRMVFERHIRSAR"
     MLLVLDIGNS NVSFGLYEGS GSAARLVGSW RAHTDPKLTG DEIYLAAEGF LGEHIDRVDG        60
     VSALSTVPAL LRELRLMIPR YFPGRRSLVV EPGVRTGVPL LVDNPKGVGA DRVVNALAAF       120
     QQCQSACVVV DAGTTTVVDA VSAKGEFLGG AIAPGMAISV DALSQWAATI PKVELVRPRS       180
     VIGKSTVESL QSGVLFGFAG QVDGLVRRMI GEIGEARVVL TGGLAPLLVD ELATPFAHEP       240
     ALTLTGLRMV FERHIRSAR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page