(data stored in ACNUC7421 zone)

EMBL: CP001958.PE427

CP001958.PE427       Location/Qualifiers
FT   CDS             414939..417467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0433"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: msm:MSMEG_6091 negative regulator of genetic
FT                   competence ClpC/MecB; PFAM: ATPase AAA-2 domain protein;
FT                   Clp domain protein; AAA ATPase central domain protein;
FT                   UvrB/UvrC protein; Clp ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96920"
FT                   /db_xref="GOA:D6ZBU3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU3"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADG96920.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKSLESLGISLEAVRSQVEEIIGQGQQGPSVHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLSRVRQQVIQLLSGYSGGGKEPEAAGAGGRGGE
FT                   AGTPSTSLVLDQFGRNLTRAALDGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGV
FT                   GKTAVVEGLAQAIVHGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINSR
FT                   GDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAAL
FT                   ERRFQPVQVGEPSVEHTIEILKGLRDRYEAHHRVSITDSALAAAASLADRYINDRFLPD
FT                   KAIDLIDEAGARMRIRRMTAPPDLREFDEKIANTRRQKESAIDEQDFEKAAGLRDTEKK
FT                   LVAQRAEREKQWRSGDMDVVAEVDEEEIAEVLANWTGIPVFKLTEEETARLLRMEDELH
FT                   KRIIGQRDAVAAVAKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANFLFGED
FT                   DALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHHE
FT                   IYNTLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKAVGLGFSSGEGNTSNYE
FT                   RMKQKVQDELKKHFRPEFLNRIDEIVVFHQLTNEEIVKMVDLMITRVAAALKAKDMEIE
FT                   LSAQAKGLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGEFGAGQKVLVDVEGWDG
FT                   ESAGEDAKFVFRAAAAAEPVLAGAGEPAGE"
     MFERFTDRAR RVVVLAQEEA RMLNHNYIGT EHILLGLIHE GEGVAAKSLE SLGISLEAVR        60
     SQVEEIIGQG QQGPSVHIPF TPRAKKVLEL SLREALQLGH NYIGTEHILL GLIREGEGVA       120
     AQVLVKLGAD LSRVRQQVIQ LLSGYSGGGK EPEAAGAGGR GGEAGTPSTS LVLDQFGRNL       180
     TRAALDGKLD PVIGREKEIE RVMQVLSRRT KNNPVLIGEP GVGKTAVVEG LAQAIVHGEV       240
     PETLKDKQLY TLDLGSLVAG SRYRGDFEER LKKVLKEINS RGDIILFIDE LHTLVGAGAA       300
     EGAIDAASIL KPKLARGELQ TIGATTLDEY RKYIEKDAAL ERRFQPVQVG EPSVEHTIEI       360
     LKGLRDRYEA HHRVSITDSA LAAAASLADR YINDRFLPDK AIDLIDEAGA RMRIRRMTAP       420
     PDLREFDEKI ANTRRQKESA IDEQDFEKAA GLRDTEKKLV AQRAEREKQW RSGDMDVVAE       480
     VDEEEIAEVL ANWTGIPVFK LTEEETARLL RMEDELHKRI IGQRDAVAAV AKAIRRTRAG       540
     LKDPKRPSGS FIFAGPSGVG KTELSKALAN FLFGEDDALI QIDMGEFHDR FTASRLFGAP       600
     PGYVGYEEGG QLTEKVRRKP FSVVLFDEIE KAHHEIYNTL LQVLEDGRLT DGQGRTVDFK       660
     NTVLIFTSNL GTSDISKAVG LGFSSGEGNT SNYERMKQKV QDELKKHFRP EFLNRIDEIV       720
     VFHQLTNEEI VKMVDLMITR VAAALKAKDM EIELSAQAKG LLAKRGFDPV LGARPLRRTI       780
     QREIEDQLSE KILFGEFGAG QKVLVDVEGW DGESAGEDAK FVFRAAAAAE PVLAGAGEPA       840
     GE                                                                      842
//

If you have problems or comments...

PBIL Back to PBIL home page