(data stored in ACNUC7421 zone)

EMBL: CP001958.PE428

CP001958.PE428       Location/Qualifiers
FT   CDS             417521..418438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0434"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mgi:Mflv_1435
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96921"
FT                   /db_xref="GOA:D6ZBU4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96921.1"
FT                   /translation="MFDQAVASARIFEHKARHSGRSPGLGRTILLLHGLMGRGSTWFRH
FT                   VPWLQELGRVITYDAAWHQGRDVDGGSVATERFVAEAAAVLEAHADMPAVVIGHSMGGL
FT                   HAWCLAAARPDLVRALVVEDMAPDFRGRTLGPWEPWLRSWPVDFPDAASVDSLVGEVAG
FT                   RYFRESFDRLPGGGYRLHGHIDAWCAIAAQWGERDYWPEWEAVSAPALLIEATGGVTPE
FT                   GQMRAMAQRKRDQGGPLVRHAALDTGHLAHDTEPQACRQLVAAFLAQDVDRSGHDERHR
FT                   GERDHALRRHECFGPMGERHGVGR"
     MFDQAVASAR IFEHKARHSG RSPGLGRTIL LLHGLMGRGS TWFRHVPWLQ ELGRVITYDA        60
     AWHQGRDVDG GSVATERFVA EAAAVLEAHA DMPAVVIGHS MGGLHAWCLA AARPDLVRAL       120
     VVEDMAPDFR GRTLGPWEPW LRSWPVDFPD AASVDSLVGE VAGRYFRESF DRLPGGGYRL       180
     HGHIDAWCAI AAQWGERDYW PEWEAVSAPA LLIEATGGVT PEGQMRAMAQ RKRDQGGPLV       240
     RHAALDTGHL AHDTEPQACR QLVAAFLAQD VDRSGHDERH RGERDHALRR HECFGPMGER       300
     HGVGR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page