(data stored in ACNUC7421 zone)

EMBL: CP001958.PE429

CP001958.PE429       Location/Qualifiers
FT   CDS             complement(418319..419077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_2694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96922"
FT                   /db_xref="GOA:D6ZBU5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU5"
FT                   /inference="similar to AA sequence:KEGG:MAB_2694"
FT                   /protein_id="ADG96922.1"
FT                   /translation="MSTADEEPGQRRPPHGARKAAGSTAHLAAELEEHTPSWLRPHNPE
FT                   NRLPVLAAMLVAVALQLAVADSYALHPRWLLFGLESVLLVVLIVLNPIRLTRHPKLSRA
FT                   FSIALVAGISVDNAVSSALLDENILTGRTGKDAVSLLGSGAAVYVTNIIAYGIWYWLLD
FT                   RGGPFARHEGRHPNPSFLFPQMTLGRLAPKNWVPRFFDYFYVSFTNATAFSPTDTMPLT
FT                   HWAKALMAAQSMVALATMALVVARAVNVLG"
     MSTADEEPGQ RRPPHGARKA AGSTAHLAAE LEEHTPSWLR PHNPENRLPV LAAMLVAVAL        60
     QLAVADSYAL HPRWLLFGLE SVLLVVLIVL NPIRLTRHPK LSRAFSIALV AGISVDNAVS       120
     SALLDENILT GRTGKDAVSL LGSGAAVYVT NIIAYGIWYW LLDRGGPFAR HEGRHPNPSF       180
     LFPQMTLGRL APKNWVPRFF DYFYVSFTNA TAFSPTDTMP LTHWAKALMA AQSMVALATM       240
     ALVVARAVNV LG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page