(data stored in ACNUC7421 zone)

EMBL: CP001958.PE43

CP001958.PE43        Location/Qualifiers
FT   CDS             34231..34542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0043"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: tmz:Tmz1t_3243 heavy metal translocating P-
FT                   type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96536"
FT                   /db_xref="GOA:D6Z9K9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K9"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_3243"
FT                   /protein_id="ADG96536.1"
FT                   /translation="MSEDMWRDAAQVAARNNAGSGGRVPLLAFVDRSDMAQVGVLIAAL
FT                   VAMAWMSADGLAWDMAGVLSFAGGFLTATLVNALVFTLMVVNGRAVLRRLAVEKGAGE"
     MSEDMWRDAA QVAARNNAGS GGRVPLLAFV DRSDMAQVGV LIAALVAMAW MSADGLAWDM        60
     AGVLSFAGGF LTATLVNALV FTLMVVNGRA VLRRLAVEKG AGE                         103
//

If you have problems or comments...

PBIL Back to PBIL home page