(data stored in ACNUC7421 zone)

EMBL: CP001958.PE430

CP001958.PE430       Location/Qualifiers
FT   CDS             419154..419573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96923.1"
FT                   /translation="MAHDDVENPDADDTAARFEENMRAGEALQPADVRAAAARYRHLAD
FT                   GILDHFHNLAATADDCEEEVPEGLDDLQRKAEHLRGYADRLLDFADRAEEAKSVVARLR
FT                   GLPSAQLSEKDKHELAKSLRDLYEPLPQMFGLDEH"
     MAHDDVENPD ADDTAARFEE NMRAGEALQP ADVRAAAARY RHLADGILDH FHNLAATADD        60
     CEEEVPEGLD DLQRKAEHLR GYADRLLDFA DRAEEAKSVV ARLRGLPSAQ LSEKDKHELA       120
     KSLRDLYEPL PQMFGLDEH                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page