(data stored in ACNUC7421 zone)

EMBL: CP001958.PE435

CP001958.PE435       Location/Qualifiers
FT   CDS             complement(423788..424735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0441"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase; PFAM: HhH-GPD family protein; SMART: HhH-GPD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96928"
FT                   /db_xref="GOA:D6ZBV1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV1"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADG96928.1"
FT                   /translation="MISSAAHPSGFEFSDGGRWPQAAQALIRWFGEHARALPWREPGVT
FT                   PWGVLLSEIMLQQTQVDRVRPIWEEWVCRWPSPAALAAQPLAEALRAWGRLGYPRRAAR
FT                   LHEASRVIVAEHDGEVPDELDALLALPGVGAYTARAVLAFAFGQRAPVVDVNVRRVLCR
FT                   VRRGEADGPARAQDLPDTLALLPQDPAAASALSAALMELGQTVCLPHAPNCAACPVHPC
FT                   RWARAGKPAAPEPAARRAPRYAGSDRQARGALLAALRASAEPLRKAELDQAWLANPVQR
FT                   ERALRSLVEDGLVHVADGGRVALGAADGRANAAE"
     MISSAAHPSG FEFSDGGRWP QAAQALIRWF GEHARALPWR EPGVTPWGVL LSEIMLQQTQ        60
     VDRVRPIWEE WVCRWPSPAA LAAQPLAEAL RAWGRLGYPR RAARLHEASR VIVAEHDGEV       120
     PDELDALLAL PGVGAYTARA VLAFAFGQRA PVVDVNVRRV LCRVRRGEAD GPARAQDLPD       180
     TLALLPQDPA AASALSAALM ELGQTVCLPH APNCAACPVH PCRWARAGKP AAPEPAARRA       240
     PRYAGSDRQA RGALLAALRA SAEPLRKAEL DQAWLANPVQ RERALRSLVE DGLVHVADGG       300
     RVALGAADGR ANAAE                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page