(data stored in ACNUC7421 zone)

EMBL: CP001958.PE437

CP001958.PE437       Location/Qualifiers
FT   CDS             complement(425448..426863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0443"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: kra:Krad_0603 DNA repair
FT                   protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96930"
FT                   /db_xref="GOA:D6ZBV3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV3"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADG96930.1"
FT                   /translation="MARTSAQESRHRCGECGSIQVKWLGRCPRCGAWASLVPICETAEG
FT                   RAASVEPMTQILGSEALTRPTGVREFDRVLGKGLVAGSVVLLAGEPGVGKSTLLLETAK
FT                   QWALAGRRCLYVSGEESPAQARARAERIGAVHEKVLFTAETQLEAILASCVEHTPELVV
FT                   VDSVQMLRCAGEAPGAISQIQEAVRRFSALAKALDISVVLIGHVTKEGEIAGPRFLEHL
FT                   VDVVLTFAGEQHSRLRLLRGVKNRFGPSDEVGCFEQNEHGISGVADPGSFLIGRREHPV
FT                   AGSVATVVMHGRRPLLGEVQALVAPSSRGGKTVVSGLRSDRVAKIVGVLSARCGLDLRE
FT                   KDVYLSTVGGMSMHEPSADLAIALAIAGAAVGEALPLGLVVFGEVALTGEAVPVTATEQ
FT                   RLAEAARLGRKSAIVPAGGELGRDQKSATGLTLMTVSTTAMALAQLRGRKEASPAKNAI
FT                   AEQTRGEPLSAAV"
     MARTSAQESR HRCGECGSIQ VKWLGRCPRC GAWASLVPIC ETAEGRAASV EPMTQILGSE        60
     ALTRPTGVRE FDRVLGKGLV AGSVVLLAGE PGVGKSTLLL ETAKQWALAG RRCLYVSGEE       120
     SPAQARARAE RIGAVHEKVL FTAETQLEAI LASCVEHTPE LVVVDSVQML RCAGEAPGAI       180
     SQIQEAVRRF SALAKALDIS VVLIGHVTKE GEIAGPRFLE HLVDVVLTFA GEQHSRLRLL       240
     RGVKNRFGPS DEVGCFEQNE HGISGVADPG SFLIGRREHP VAGSVATVVM HGRRPLLGEV       300
     QALVAPSSRG GKTVVSGLRS DRVAKIVGVL SARCGLDLRE KDVYLSTVGG MSMHEPSADL       360
     AIALAIAGAA VGEALPLGLV VFGEVALTGE AVPVTATEQR LAEAARLGRK SAIVPAGGEL       420
     GRDQKSATGL TLMTVSTTAM ALAQLRGRKE ASPAKNAIAE QTRGEPLSAA V                471
//

If you have problems or comments...

PBIL Back to PBIL home page