(data stored in ACNUC7421 zone)

EMBL: CP001958.PE438

CP001958.PE438       Location/Qualifiers
FT   CDS             complement(426934..427506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: car:cauri_2217 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96931"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96931.1"
FT                   /translation="MAVTTNQRRPLLALVAGLAAAAALCSCSAGWNTQTGSQLAAIDGT
FT                   SINSDLDGVGVRNAYIAVSGQEGSLSFVAVNPSIRLVRLSSVTVVYPSGKRQNLSALAN
FT                   KDIPAQGRLQVGPVPADASGIARADFAPSPSLDMAGEQLAPGLSVKIEFNVVAPPSHDP
FT                   DFPQEKRTSFQGPVPIIGKGESPAKKD"
     MAVTTNQRRP LLALVAGLAA AAALCSCSAG WNTQTGSQLA AIDGTSINSD LDGVGVRNAY        60
     IAVSGQEGSL SFVAVNPSIR LVRLSSVTVV YPSGKRQNLS ALANKDIPAQ GRLQVGPVPA       120
     DASGIARADF APSPSLDMAG EQLAPGLSVK IEFNVVAPPS HDPDFPQEKR TSFQGPVPII       180
     GKGESPAKKD                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page