(data stored in ACNUC7421 zone)

EMBL: CP001958.PE442

CP001958.PE442       Location/Qualifiers
FT   CDS             430882..431772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0448"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: mjl:Mjls_5122 RNA methyltransferase; TIGRFAM:
FT                   RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96935"
FT                   /db_xref="GOA:D6ZBV8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV8"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADG96935.1"
FT                   /translation="MAPGPRRRGLRGKGPTPPATARTGHPAARRAAAQEAAKTRARAVR
FT                   QAADAPEWVLGRNPVLECLRAKVPAVELLVASGIDADERVAESVRIAGNVGVPVTEVAR
FT                   FELDRRSSGAPHQGIGLRVRPYEYHHPEDLLTEAENSGRPALFVALDHISDPRNLGAVV
FT                   RSAAAFGGHGVLIPNRRSASLTAIAWRTSAGAAARLPVAQAPNLARSLKQWQERGLLLV
FT                   GLDAEGDTSLDDFTGTEPLALVVGSEGKGLSRLVRESCDFVVSIPMSGQVESLNVSVAT
FT                   GVVLGEIARQRRNAR"
     MAPGPRRRGL RGKGPTPPAT ARTGHPAARR AAAQEAAKTR ARAVRQAADA PEWVLGRNPV        60
     LECLRAKVPA VELLVASGID ADERVAESVR IAGNVGVPVT EVARFELDRR SSGAPHQGIG       120
     LRVRPYEYHH PEDLLTEAEN SGRPALFVAL DHISDPRNLG AVVRSAAAFG GHGVLIPNRR       180
     SASLTAIAWR TSAGAAARLP VAQAPNLARS LKQWQERGLL LVGLDAEGDT SLDDFTGTEP       240
     LALVVGSEGK GLSRLVRESC DFVVSIPMSG QVESLNVSVA TGVVLGEIAR QRRNAR           296
//

If you have problems or comments...

PBIL Back to PBIL home page