(data stored in ACNUC7421 zone)

EMBL: CP001958.PE45

CP001958.PE45        Location/Qualifiers
FT   CDS             34748..34984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: seu:SEQ_0231 Mga-like regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96538"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96538.1"
FT                   /translation="MSDELPIGVVGRRIVSIAEGARRIVEPSAYDSSPFVHDGLVIGLD
FT                   DGSELFIQDNGEYYPGFFTHWLGQSITEERTQQ"
     MSDELPIGVV GRRIVSIAEG ARRIVEPSAY DSSPFVHDGL VIGLDDGSEL FIQDNGEYYP        60
     GFFTHWLGQS ITEERTQQ                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page