(data stored in ACNUC7421 zone)

EMBL: CP001958.PE450

CP001958.PE450       Location/Qualifiers
FT   CDS             complement(438139..438702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0456"
FT                   /product="Trp biosynthesis associated, transmembrane
FT                   protein, Oprn/Chp"
FT                   /note="PFAM: Trp biosynthesis associated, transmembrane
FT                   protein, Oprn/Chp; KEGG: rop:ROP_07410 hypothetical
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96943"
FT                   /db_xref="GOA:D6ZBW6"
FT                   /db_xref="InterPro:IPR019051"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW6"
FT                   /inference="protein motif:PFAM:PF09534"
FT                   /protein_id="ADG96943.1"
FT                   /translation="MKRPLAWASLLLVCAGAGAYGSSRATWAVASAHDGLGAPRDVRVL
FT                   GSDFAPLTIALALLLIAAVPAVFAVKGWTLRAVALAVGLAGAGLVWAGAHWLADKPDSA
FT                   QAARLAALPERYQVDHLVVSRTSGGLPLAAGAMALGACVFILRAARAAQGLGSRFDSPA
FT                   AKKDRPEVERSAWAALDAGEDPTL"
     MKRPLAWASL LLVCAGAGAY GSSRATWAVA SAHDGLGAPR DVRVLGSDFA PLTIALALLL        60
     IAAVPAVFAV KGWTLRAVAL AVGLAGAGLV WAGAHWLADK PDSAQAARLA ALPERYQVDH       120
     LVVSRTSGGL PLAAGAMALG ACVFILRAAR AAQGLGSRFD SPAAKKDRPE VERSAWAALD       180
     AGEDPTL                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page