(data stored in ACNUC7421 zone)

EMBL: CP001958.PE455

CP001958.PE455       Location/Qualifiers
FT   CDS             441536..441847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0461"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: rer:RER_26320 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96948"
FT                   /db_xref="GOA:D6ZBX1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX1"
FT                   /inference="similar to AA sequence:KEGG:RER_26320"
FT                   /protein_id="ADG96948.1"
FT                   /translation="MFPASARRQKRLSAAVLALAAFGMVVTGGMSAAAASGGGYGPIPV
FT                   PVHPMPQSPPAGASPKAFHPVPAPHGTIPKPAPGSRSPRPAAPTVAPGAGVDDSDDDS"
     MFPASARRQK RLSAAVLALA AFGMVVTGGM SAAAASGGGY GPIPVPVHPM PQSPPAGASP        60
     KAFHPVPAPH GTIPKPAPGS RSPRPAAPTV APGAGVDDSD DDS                         103
//

If you have problems or comments...

PBIL Back to PBIL home page