(data stored in ACNUC7421 zone)

EMBL: CP001958.PE458

CP001958.PE458       Location/Qualifiers
FT   CDS             complement(443506..444429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0464"
FT                   /product="Glucose-6-phosphate dehydrogenase subunit"
FT                   /note="PFAM: Glucose-6-phosphate dehydrogenase subunit;
FT                   KEGG: rer:RER_30420 OxPP cycle protein OpcA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96951"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX4"
FT                   /inference="protein motif:PFAM:PF10128"
FT                   /protein_id="ADG96951.1"
FT                   /translation="MSIIDLPATTTEKISKRLVALRTATGNPAVSRVLTLVVCVEDGED
FT                   VELAISAAGTANREHPCRVIIVAKGQRYAATRLDAQIRVGGDAGASEVVVLRLYGPLAD
FT                   HGDSVVIPFLLPDTPVVAWWPGLAPEVPAEDPIGALASRRVTNSITAADAAASLAKLVH
FT                   GYAPGDTDLVWARATPIRSILTASLDEPNYEPVTEAVVLGPEPSITLDLVAGWLAARLA
FT                   VPVRRGAGSLEISLHRHGGTLSLTQDRRGNGRVVRPGRPESAVSLFHQDVPALLAQELR
FT                   FMDPDEVYEQALQGFGSVTKDEEAAA"
     MSIIDLPATT TEKISKRLVA LRTATGNPAV SRVLTLVVCV EDGEDVELAI SAAGTANREH        60
     PCRVIIVAKG QRYAATRLDA QIRVGGDAGA SEVVVLRLYG PLADHGDSVV IPFLLPDTPV       120
     VAWWPGLAPE VPAEDPIGAL ASRRVTNSIT AADAAASLAK LVHGYAPGDT DLVWARATPI       180
     RSILTASLDE PNYEPVTEAV VLGPEPSITL DLVAGWLAAR LAVPVRRGAG SLEISLHRHG       240
     GTLSLTQDRR GNGRVVRPGR PESAVSLFHQ DVPALLAQEL RFMDPDEVYE QALQGFGSVT       300
     KDEEAAA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page