(data stored in ACNUC7421 zone)

EMBL: CP001958.PE462

CP001958.PE462       Location/Qualifiers
FT   CDS             449705..450661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0468"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="KEGG: nfa:nfa35720 protoheme IX farnesyltransferase;
FT                   TIGRFAM: protoheme IX farnesyltransferase; PFAM: UbiA
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96955"
FT                   /db_xref="GOA:D6ZBX8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX8"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ADG96955.1"
FT                   /translation="MPVSADPVERGVSAPSLGAGRVLALARDYLALTKPRVIELLLVAT
FT                   IPVMLLAHRGTVDLRLILETLFGGWLGAASANTLNCVVDADIDKVMDRTKNRPLARGAM
FT                   SRRAALLFGLGLGSASFLWLWRSANLLAASLVVATIAFYVLVYSMFLKRRTSQNVVWGG
FT                   AAGCMPALVGWAAVTGSLDWPALVVFMVIFFWTPPHTWSLAMKYRDDYSTAGVPMLPTV
FT                   ADERLVAKRMVWYTWATVLTTFALIPVVGLLYAGVAIAAGSWFLYEAHRLSAGLAAGRP
FT                   VTPFRLFLQSNNYLAAVFVGLAVDSALAWPTVASLLS"
     MPVSADPVER GVSAPSLGAG RVLALARDYL ALTKPRVIEL LLVATIPVML LAHRGTVDLR        60
     LILETLFGGW LGAASANTLN CVVDADIDKV MDRTKNRPLA RGAMSRRAAL LFGLGLGSAS       120
     FLWLWRSANL LAASLVVATI AFYVLVYSMF LKRRTSQNVV WGGAAGCMPA LVGWAAVTGS       180
     LDWPALVVFM VIFFWTPPHT WSLAMKYRDD YSTAGVPMLP TVADERLVAK RMVWYTWATV       240
     LTTFALIPVV GLLYAGVAIA AGSWFLYEAH RLSAGLAAGR PVTPFRLFLQ SNNYLAAVFV       300
     GLAVDSALAW PTVASLLS                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page