(data stored in ACNUC7421 zone)

EMBL: CP001958.PE468

CP001958.PE468       Location/Qualifiers
FT   CDS             455953..457539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0474"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: mjl:Mjls_3521 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96961"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY4"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADG96961.1"
FT                   /translation="MKPGTDKTKPEKSAKSSQSQSQSKGGQRQSQTQGGGAQLDGAFED
FT                   YTESPGFEKNFDEMFEQDGSARAPYRGVFQALEPLDSDDLNARAEALGRAFINQGITFS
FT                   LSGQERPFPLDLVPRVIAAAEWAKLEKGITQRVRALEAFLDDVYGDQEILRDGVIPRSL
FT                   IFSCQHFHRQASGIRPPNGVRIHVAGIDIIRDGQGTFRVLEDNLRNPSGVSYVMENRRT
FT                   MTRVFPDLFGTHRVRPVDDYPAHLLRALRAAAATNEDDPTVVVLTPGVANSAHFEHSLL
FT                   ARQMGVELVEGRDLFCRDNIVYMRTTEGEVQVDVIYRRIDDEYLDPLQFKPESLLGVAG
FT                   IVNAARAGNVVISSAVGNGVGDDKLVYTYVPSMIEYYLGEKPLLANVDTYRCWIPHELE
FT                   QTLDRINELVLKPVEGSGGYGIVFGPDASEKELAAMSRKIRANPRDWVAQPVMQLSTVP
FT                   TKIGDKVAPRHVDLRPFAVNDGENVWVLPGGLTRVALKEGSLVVNSSQGGGSKDTWVLG
FT                   NRSQAKTEVAS"
     MKPGTDKTKP EKSAKSSQSQ SQSKGGQRQS QTQGGGAQLD GAFEDYTESP GFEKNFDEMF        60
     EQDGSARAPY RGVFQALEPL DSDDLNARAE ALGRAFINQG ITFSLSGQER PFPLDLVPRV       120
     IAAAEWAKLE KGITQRVRAL EAFLDDVYGD QEILRDGVIP RSLIFSCQHF HRQASGIRPP       180
     NGVRIHVAGI DIIRDGQGTF RVLEDNLRNP SGVSYVMENR RTMTRVFPDL FGTHRVRPVD       240
     DYPAHLLRAL RAAAATNEDD PTVVVLTPGV ANSAHFEHSL LARQMGVELV EGRDLFCRDN       300
     IVYMRTTEGE VQVDVIYRRI DDEYLDPLQF KPESLLGVAG IVNAARAGNV VISSAVGNGV       360
     GDDKLVYTYV PSMIEYYLGE KPLLANVDTY RCWIPHELEQ TLDRINELVL KPVEGSGGYG       420
     IVFGPDASEK ELAAMSRKIR ANPRDWVAQP VMQLSTVPTK IGDKVAPRHV DLRPFAVNDG       480
     ENVWVLPGGL TRVALKEGSL VVNSSQGGGS KDTWVLGNRS QAKTEVAS                    528
//

If you have problems or comments...

PBIL Back to PBIL home page