(data stored in ACNUC7421 zone)

EMBL: CP001958.PE480

CP001958.PE480       Location/Qualifiers
FT   CDS             complement(469093..469500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mdi:METDI3948 thiamin-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96973"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96973.1"
FT                   /translation="MPSRARAFFLAAACLVASGCAPQPPTSEPDIVYAVTAAGSSEVWV
FT                   RYLKDIEPGGGAGKRRGVEAQENARTPFTRTARLGQGWTHAWIEATTEPVDRTVKLHCA
FT                   LQHNGTTVTEGNGLGFVSCGSPADGNAAPPA"
     MPSRARAFFL AAACLVASGC APQPPTSEPD IVYAVTAAGS SEVWVRYLKD IEPGGGAGKR        60
     RGVEAQENAR TPFTRTARLG QGWTHAWIEA TTEPVDRTVK LHCALQHNGT TVTEGNGLGF       120
     VSCGSPADGN AAPPA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page