(data stored in ACNUC7421 zone)

EMBL: CP001958.PE481

CP001958.PE481       Location/Qualifiers
FT   CDS             complement(469506..469916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96974"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96974.1"
FT                   /translation="MRRPVLIALLSLCLVVSGCGKHERGNGSHNVTYEITGVGVSGKIK
FT                   ISYLSHMGRPKAGKKIPSRRSSDYAAVPYTKEVTLGDFWDHANIHANDPGTNDNTASLT
FT                   CTIKHDGAVIATKTGTRSVTCEAPKSATAESN"
     MRRPVLIALL SLCLVVSGCG KHERGNGSHN VTYEITGVGV SGKIKISYLS HMGRPKAGKK        60
     IPSRRSSDYA AVPYTKEVTL GDFWDHANIH ANDPGTNDNT ASLTCTIKHD GAVIATKTGT       120
     RSVTCEAPKS ATAESN                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page