(data stored in ACNUC7421 zone)

EMBL: CP001958.PE483

CP001958.PE483       Location/Qualifiers
FT   CDS             471087..471662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0489"
FT                   /product="chorismate mutase"
FT                   /note="KEGG: mkm:Mkms_2781 chorismate mutase; TIGRFAM:
FT                   chorismate mutase; PFAM: Chorismate mutase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96976"
FT                   /db_xref="GOA:D6ZBZ9"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ9"
FT                   /inference="protein motif:TFAM:TIGR01806"
FT                   /protein_id="ADG96976.1"
FT                   /translation="MTMGALSKTVAAFLVAGAFACGPVPAAMANGVAAELVVQAAADRL
FT                   AVSSDVAASKWFSGGAIHDQARADDVLEDAAEQGSAAGLDQDRVRALFEDQIAAAEGEE
FT                   YARFAEWSFDPRSAPQAPTDLSSARARINEASSRLIQAYAQFAQKTAAKPACGAQVRAA
FT                   LAAEVSRRGWGAQWARGMRRAATHFCTG"
     MTMGALSKTV AAFLVAGAFA CGPVPAAMAN GVAAELVVQA AADRLAVSSD VAASKWFSGG        60
     AIHDQARADD VLEDAAEQGS AAGLDQDRVR ALFEDQIAAA EGEEYARFAE WSFDPRSAPQ       120
     APTDLSSARA RINEASSRLI QAYAQFAQKT AAKPACGAQV RAALAAEVSR RGWGAQWARG       180
     MRRAATHFCT G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page