(data stored in ACNUC7421 zone)

EMBL: CP001958.PE486

CP001958.PE486       Location/Qualifiers
FT   CDS             complement(473278..475233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1344 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96979"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96979.1"
FT                   /translation="MTIHIPDGLKWVFEMAGGGQWPEGDEDAVREVAKGHEAYAKALEE
FT                   DLQKFNDAMSLAKDSVEGKIHDALADLEQKVADQLKQVADAHHNQAKALKDAANTIEYT
FT                   KGMMIAALVTLAAEIATAIAMMPFTCGASAAAEAAAIAAAKVLFNTLSREMILKLMRAA
FT                   TIAAVVGIEDVALKTVSSVVTQKVQVDKGTRDKIDGDLVRDAAKTSGIGAAAGLLGAPL
FT                   GAVAGGAVEKGLQAAGGAAAKAAGVEVGETTAGKLGEFASKQLGGAADAVTGSAVTGGI
FT                   TSAATGQKFDPATLAGAAAGKAAGSVVGKGVEKGSAAATKSIPESSGLKSAIEPATDLG
FT                   KSMASEVAKTAAEQGAIAGINHTPFDTDKLAGAPVKGGLESAKGGFGKAEKLQAEASKE
FT                   KPVAGPQPQGTVPPGTQGPQPEGALPHTARTPTENLQGPKEKPVAGPQPQGTVPPGTQG
FT                   PQPEGALPHTTRTPTENLQSSVPHADSSSAGSAHAQPPAPHSGSGGAQQAGQQASPPGQ
FT                   GISNTPAGHMGADLRGFGSGAPAAGTPLAATSPQGESPSVEPASGAVSPQAGSVGAPPQ
FT                   RAASAPPILERQFDQNVRPVQTAEPVVGDLTPGERDERDHVLAMYEAQSAAADDDVWEA
FT                   GRDMGSDAMDRSASAR"
     MTIHIPDGLK WVFEMAGGGQ WPEGDEDAVR EVAKGHEAYA KALEEDLQKF NDAMSLAKDS        60
     VEGKIHDALA DLEQKVADQL KQVADAHHNQ AKALKDAANT IEYTKGMMIA ALVTLAAEIA       120
     TAIAMMPFTC GASAAAEAAA IAAAKVLFNT LSREMILKLM RAATIAAVVG IEDVALKTVS       180
     SVVTQKVQVD KGTRDKIDGD LVRDAAKTSG IGAAAGLLGA PLGAVAGGAV EKGLQAAGGA       240
     AAKAAGVEVG ETTAGKLGEF ASKQLGGAAD AVTGSAVTGG ITSAATGQKF DPATLAGAAA       300
     GKAAGSVVGK GVEKGSAAAT KSIPESSGLK SAIEPATDLG KSMASEVAKT AAEQGAIAGI       360
     NHTPFDTDKL AGAPVKGGLE SAKGGFGKAE KLQAEASKEK PVAGPQPQGT VPPGTQGPQP       420
     EGALPHTART PTENLQGPKE KPVAGPQPQG TVPPGTQGPQ PEGALPHTTR TPTENLQSSV       480
     PHADSSSAGS AHAQPPAPHS GSGGAQQAGQ QASPPGQGIS NTPAGHMGAD LRGFGSGAPA       540
     AGTPLAATSP QGESPSVEPA SGAVSPQAGS VGAPPQRAAS APPILERQFD QNVRPVQTAE       600
     PVVGDLTPGE RDERDHVLAM YEAQSAAADD DVWEAGRDMG SDAMDRSASA R                651
//

If you have problems or comments...

PBIL Back to PBIL home page