(data stored in ACNUC7421 zone)

EMBL: CP001958.PE487

CP001958.PE487       Location/Qualifiers
FT   CDS             complement(475230..475763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96980"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96980.1"
FT                   /translation="MADGKIEMDYDGFRSAGHHLQSLSESVRSSYQTFLSATEGRGEPW
FT                   GHDKFGKSFAEGKDKYKESMESLKKLAEGDGGDGYIEALDEFGKNILNAADQIESKDND
FT                   EGRNIQQVDKQTDAATPRYTLQGAGADSGDAGADGERMRLPHADFGRFGRIGVVTSAAE
FT                   DGVEPPGQADGGVA"
     MADGKIEMDY DGFRSAGHHL QSLSESVRSS YQTFLSATEG RGEPWGHDKF GKSFAEGKDK        60
     YKESMESLKK LAEGDGGDGY IEALDEFGKN ILNAADQIES KDNDEGRNIQ QVDKQTDAAT       120
     PRYTLQGAGA DSGDAGADGE RMRLPHADFG RFGRIGVVTS AAEDGVEPPG QADGGVA          177
//

If you have problems or comments...

PBIL Back to PBIL home page