(data stored in ACNUC7421 zone)

EMBL: CP001958.PE492

CP001958.PE492       Location/Qualifiers
FT   CDS             complement(480027..480539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_18580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96985"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96985.1"
FT                   /translation="MSTPEPDPVLDIARGDPAVSKALSSSLKILRNKSDDPAFKTMVDE
FT                   ILAGKKSLREAASSQAFNQGIADKAQAGFEWYRNLSEEERERGAEQGRSQLARLREELL
FT                   YQPKEQPHSQEDGADDDDESSFDYSDPLRRNAKDEDFPTHSSLRHLEEADDEDEGFDPS
FT                   DPLGRRR"
     MSTPEPDPVL DIARGDPAVS KALSSSLKIL RNKSDDPAFK TMVDEILAGK KSLREAASSQ        60
     AFNQGIADKA QAGFEWYRNL SEEERERGAE QGRSQLARLR EELLYQPKEQ PHSQEDGADD       120
     DDESSFDYSD PLRRNAKDED FPTHSSLRHL EEADDEDEGF DPSDPLGRRR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page