(data stored in ACNUC7421 zone)

EMBL: CP001958.PE497

CP001958.PE497       Location/Qualifiers
FT   CDS             complement(484868..485533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0506"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa49510 putative ribosomal-protein- alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96990"
FT                   /db_xref="GOA:D6ZC13"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC13"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96990.1"
FT                   /translation="MAKTVANPVLGPVTTPGGEVRLRPIRLTDARSWSQARIADQQHLE
FT                   PWEPGPGRGWEERHKAQHWLSLWSQLRAHTKKGVVYPLVIEVDRTYAGQLTIGGVQRGA
FT                   LQSAWIGYWVASRVCGGGVATAAAALAVDWCFQTLKLHRVEATTRRENFASKTVLERIG
FT                   FREEGLIKDYLVVQGMWRDHVLFGLTAPETRGGVVNRLVREGKILGAAPPAGGRARLL"
     MAKTVANPVL GPVTTPGGEV RLRPIRLTDA RSWSQARIAD QQHLEPWEPG PGRGWEERHK        60
     AQHWLSLWSQ LRAHTKKGVV YPLVIEVDRT YAGQLTIGGV QRGALQSAWI GYWVASRVCG       120
     GGVATAAAAL AVDWCFQTLK LHRVEATTRR ENFASKTVLE RIGFREEGLI KDYLVVQGMW       180
     RDHVLFGLTA PETRGGVVNR LVREGKILGA APPAGGRARL L                           221
//

If you have problems or comments...

PBIL Back to PBIL home page