(data stored in ACNUC7421 zone)

EMBL: CP001958.PE499

CP001958.PE499       Location/Qualifiers
FT   CDS             complement(486798..487781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0508"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mpa:MAP0924
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96992"
FT                   /db_xref="GOA:D6ZC15"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC15"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADG96992.1"
FT                   /translation="MAENENSLSTLPRPGMPHTAVVPAAGMGTRFLPVTKSVPKELLPV
FT                   VDTPGIELVAAEAAQAGAQRLVIVTSEGKDSVVAHFVEDLVLESALEAKGKSAMLEKVR
FT                   RAPKLIKVESVIQHQPLGLGHAIAQVEPLLHPDDDAIAVLLPDDLVLKSPQQVAQERER
FT                   DICDQIEIREKVGALNLMAQVRAEHGGSVICAFPVPREEISAYGVFDVVEQEGPVRRVR
FT                   GLVEKPPAEKAPSNLAVAGRYILERAIFDALREVAPGAGGEIQLTDAIALLIDRGRPVH
FT                   LVVWDGYRHDLGNPGGYLKASIDFALDREEYGPGLRAWLISRLGLS"
     MAENENSLST LPRPGMPHTA VVPAAGMGTR FLPVTKSVPK ELLPVVDTPG IELVAAEAAQ        60
     AGAQRLVIVT SEGKDSVVAH FVEDLVLESA LEAKGKSAML EKVRRAPKLI KVESVIQHQP       120
     LGLGHAIAQV EPLLHPDDDA IAVLLPDDLV LKSPQQVAQE RERDICDQIE IREKVGALNL       180
     MAQVRAEHGG SVICAFPVPR EEISAYGVFD VVEQEGPVRR VRGLVEKPPA EKAPSNLAVA       240
     GRYILERAIF DALREVAPGA GGEIQLTDAI ALLIDRGRPV HLVVWDGYRH DLGNPGGYLK       300
     ASIDFALDRE EYGPGLRAWL ISRLGLS                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page