(data stored in ACNUC7421 zone)

EMBL: CP001958.PE500

CP001958.PE500       Location/Qualifiers
FT   CDS             488006..488560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0509"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="KEGG: svi:Svir_32680 5,10-methenyltetrahydrofolate
FT                   synthetase; TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96993"
FT                   /db_xref="GOA:D6ZC16"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC16"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ADG96993.1"
FT                   /translation="MGPQSSAQRKAALRAQTRSARRALSDAQRAARDRAVDAQAARIAE
FT                   RFGPGDVVSSYVPTSLEPGSDRMLAAFADRGASVLVPVVVGVDAALAWRHWPEEGQDAP
FT                   PGALAEAAVVLVPALAVDRRGVRLGQGGGHYDRSLAEAGPGAMLVAVVDDRELVDELPC
FT                   EPHDELLGWALTPKGLWRLGG"
     MGPQSSAQRK AALRAQTRSA RRALSDAQRA ARDRAVDAQA ARIAERFGPG DVVSSYVPTS        60
     LEPGSDRMLA AFADRGASVL VPVVVGVDAA LAWRHWPEEG QDAPPGALAE AAVVLVPALA       120
     VDRRGVRLGQ GGGHYDRSLA EAGPGAMLVA VVDDRELVDE LPCEPHDELL GWALTPKGLW       180
     RLGG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page