(data stored in ACNUC7421 zone)

EMBL: CP001958.PE501

CP001958.PE501       Location/Qualifiers
FT   CDS             complement(488582..489472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96994"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="InterPro:IPR038232"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96994.1"
FT                   /translation="MQFRVCAGGLCHYTERMFPRSRPRAAPVPARAATGLASRPQRGGA
FT                   DLLALAERASERADTLAKPLEQARLPSFPLLKITRALGVAVTITALASCGDPKEPGARR
FT                   AQSSQRVAPIAAEAIQSLFEPGHFNASGNIESMYSSASPPECRALVLEVDSPLLMRGQV
FT                   ASASAIAPKPGDKEHAQIVEIAAVYREGFSATDVIAEAAAMREHCEGTPITGSTQGGGN
FT                   STFQLIGQPSSGSPNILLWTLSALGKAWFCNNALIAAHNAAVEITSCYPSPAPKMRELA
FT                   QSALSRIERQARSSR"
     MQFRVCAGGL CHYTERMFPR SRPRAAPVPA RAATGLASRP QRGGADLLAL AERASERADT        60
     LAKPLEQARL PSFPLLKITR ALGVAVTITA LASCGDPKEP GARRAQSSQR VAPIAAEAIQ       120
     SLFEPGHFNA SGNIESMYSS ASPPECRALV LEVDSPLLMR GQVASASAIA PKPGDKEHAQ       180
     IVEIAAVYRE GFSATDVIAE AAAMREHCEG TPITGSTQGG GNSTFQLIGQ PSSGSPNILL       240
     WTLSALGKAW FCNNALIAAH NAAVEITSCY PSPAPKMREL AQSALSRIER QARSSR           296
//

If you have problems or comments...

PBIL Back to PBIL home page