(data stored in ACNUC7421 zone)

EMBL: CP001958.PE502

CP001958.PE502       Location/Qualifiers
FT   CDS             489658..490287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0511"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: rha:RHA1_ro05695 50S ribosomal protein
FT                   L25/general stress protein Ctc; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96995"
FT                   /db_xref="GOA:D6ZC18"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC18"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADG96995.1"
FT                   /translation="MAETARVEATVRDEFGKGASRRARRDGHVPAVLYGHGIDPKHFNI
FT                   PAKEFARVLRANGVNAIVSLHAGGEEHLALTKTVVVHPTKSYLQHVDLQVIRRGERIAV
FT                   DVPVVLTGSAASGSVVQHETTTLSVEAEAMHIPEQIEVSIEGLEIGSKIIASELELPEA
FT                   VSLTGDPEQMIVQINEARAAQVEQDSAEGSDEAEADSSAEDGGEES"
     MAETARVEAT VRDEFGKGAS RRARRDGHVP AVLYGHGIDP KHFNIPAKEF ARVLRANGVN        60
     AIVSLHAGGE EHLALTKTVV VHPTKSYLQH VDLQVIRRGE RIAVDVPVVL TGSAASGSVV       120
     QHETTTLSVE AEAMHIPEQI EVSIEGLEIG SKIIASELEL PEAVSLTGDP EQMIVQINEA       180
     RAAQVEQDSA EGSDEAEADS SAEDGGEES                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page