(data stored in ACNUC7421 zone)

EMBL: CP001958.PE506

CP001958.PE506       Location/Qualifiers
FT   CDS             492039..492887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0515"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: rop:ROP_58390
FT                   hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96999"
FT                   /db_xref="GOA:D6ZC22"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC22"
FT                   /inference="protein motif:PFAM:PF03239"
FT                   /protein_id="ADG96999.1"
FT                   /translation="MLFANALIGLREGLEASIIVTILCAFLVKSGLKSHVKWVWTGVAV
FT                   ALGITVTVFLVITYGSSTLSSLGQEFVGGVASLVAVAIVTTMVLWMRTAAASLSGDLKA
FT                   ALAKAVSLGPAAVVLMSGLAVGREGIETALLVFDTTQSNPSSLYGLLVGVAVAVALAIA
FT                   MYFGALRINLSAFFKVTGVLLVFVAAGVLRYGVNDLQEAGALPGSERLAFDVSGTIDPN
FT                   TWPAKLVEGMFNIVPNPTLLSAIAWLVYVVVVLAVFLRPVRPQSAAPPAAQAQRGVSAD
FT                   S"
     MLFANALIGL REGLEASIIV TILCAFLVKS GLKSHVKWVW TGVAVALGIT VTVFLVITYG        60
     SSTLSSLGQE FVGGVASLVA VAIVTTMVLW MRTAAASLSG DLKAALAKAV SLGPAAVVLM       120
     SGLAVGREGI ETALLVFDTT QSNPSSLYGL LVGVAVAVAL AIAMYFGALR INLSAFFKVT       180
     GVLLVFVAAG VLRYGVNDLQ EAGALPGSER LAFDVSGTID PNTWPAKLVE GMFNIVPNPT       240
     LLSAIAWLVY VVVVLAVFLR PVRPQSAAPP AAQAQRGVSA DS                          282
//

If you have problems or comments...

PBIL Back to PBIL home page