(data stored in ACNUC7421 zone)

EMBL: CP001958.PE513

CP001958.PE513       Location/Qualifiers
FT   CDS             complement(499660..499932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: car:cauri_0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97006"
FT                   /db_xref="InterPro:IPR032716"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97006.1"
FT                   /translation="MTASTVVPHATEETSRGPIDFTVVKGNPTDEEVAALSAVLAELWA
FT                   QRLWERDTRRHPRDLWRAGDQQLSYIPGGLPQSFLQEPSPPWRGA"
     MTASTVVPHA TEETSRGPID FTVVKGNPTD EEVAALSAVL AELWAQRLWE RDTRRHPRDL        60
     WRAGDQQLSY IPGGLPQSFL QEPSPPWRGA                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page